Creamy Vegetable Soup Recipe - Broccoli, Potatoes & Carrots
30-MINUTE MEALS! Get the email series now
Yummique

Creamy Vegetable Soup (Broccoli, Potato & Carrot)

5 from 1 vote
1 Comments
Amira
By: AmiraUpdated: Aug 18, 2026
This post may contain affiliate links. Please read our disclosure policy.

A cozy, nourishing creamy vegetable soup made with broccoli, russet potatoes, carrots, sharp cheddar, and simple pantry staples. Comfort in a bowl for chilly nights.

Creamy Vegetable Soup (Broccoli, Potato & Carrot)

This creamy vegetable soup has been my go-to cold-weather comfort bowl since I first improvised it one blustery November evening. I wanted something hearty but not heavy, a pot that would warm us up and still feel nourishing. The combination of tender russet potatoes, sweet carrots, and bright broccoli, finished with freshly grated sharp cheddar and a touch of milk, gives a velvety texture and balanced flavor that always brings everyone to the table.

I discovered this particular mix when I needed to use up vegetables from the crisper and also wanted a dish that would be simple enough for a weeknight yet special enough for guests. What makes this soup memorable is the careful sizing of the vegetables so they cook evenly, and the fresh cheddar melted in at the end for a glossy finish. The potatoes break down slightly during simmering and help thicken the base naturally, while small florets of broccoli add color and tender bites throughout.

Why You'll Love This Recipe

  • This comes together in under an hour: about 15 minutes active prep and 35 minutes simmering—perfect for weeknights when you want hearty without a fuss.
  • Uses pantry staples and common produce: onion, garlic, carrots, russet potatoes, broccoli, milk, and cheese—no exotic ingredients required.
  • Make-ahead friendly: flavors deepen if you refrigerate overnight, and it reheats beautifully for lunches or quick dinners.
  • Textural balance: creamy base from potatoes and milk with small diced vegetables and tender broccoli florets for pleasant contrast.
  • Accessible for cooks of any level: straightforward stovetop technique with clear visual cues for doneness and thickness control.
  • Family-approved: picky eaters tend to like it because the cheese adds familiar comfort while vegetables melt into the broth when desired.

My family’s reaction the first time I served this was immediate: quiet spoons followed by requests for seconds. Over time I’ve found small tweaks—grating the cheese fresh, keeping vegetable pieces small—that elevate the texture and mouthfeel. It’s the kind of bowl that becomes associated with slow evenings and simple comforts.

Ingredients

  • Unsalted butter (2 tablespoons): Use real butter for depth; it helps soften the aromatics and gives the soup a silkier mouthfeel. If you prefer salted butter, reduce added salt slightly.
  • Yellow onion (1, diced): A medium yellow onion provides sweetness when sweated slowly—look for firm, dry-skinned bulbs with no soft spots.
  • Garlic (10 cloves, minced): Fresh garlic gives brightness; mince finely so it disperses evenly through the soup without big raw pieces.
  • Carrots (1 lb, peeled and diced): Sweetness and color come from carrots. Dice small (about 1/4 to 1/2 inch) so they soften in the allotted time.
  • Russet potatoes (2 large, peeled and diced): Starchy potatoes break down slightly and thicken the base—dice small for even cooking. Russets offer the best creamy breakdown.
  • Vegetable broth (32 fl oz): Use a good-quality low-sodium broth for control over final seasoning; you can adjust salt at the end.
  • Broccoli florets (2 cups, finely diced): Small florets cook quickly and retain a pleasant bite—trim into small pieces so they heat through in 10–15 minutes.
  • Sharp yellow cheddar (8 oz, freshly grated): Freshly grate for best melting and glossy finish; pre-shredded cheeses contain anti-caking agents that inhibit smooth melting.
  • Whole milk (2 cups): Adds creaminess without heavy cream; for a richer bowl, substitute half-and-half or add a splash of cream at the end.
  • All-purpose flour (2 tablespoons): Mixed into the milk to form a liaison that gently thickens the broth; whisk to avoid lumps.
  • Salt: Season to taste at the end; the final amount depends on your broth and cheese choices.

Instructions

Prepare Ingredients: Peel and dice the potatoes into small, even pieces (about 1/4–1/2 inch). Peel and dice carrots similarly. Finely dice onion and mince garlic. Chop broccoli into small florets so they cook through quickly. Having everything prepped saves time and ensures sequential cooking goes smoothly. Sweat Aromatics: In a heavy Dutch oven or large pot over medium-low heat, melt 2 tablespoons butter. Add diced onion and minced garlic and cook for 7–10 minutes until the onion is softened and translucent—do not brown. Sweating the aromatics gently extracts sweetness and creates a flavorful base. Add Carrots: Stir in the diced carrots and cook for about 5 minutes over medium heat, stirring occasionally. This head start softens the carrots so they reach tenderness at the same time as the potatoes. Simmer Potatoes: Add diced potatoes and pour in 32 fl oz vegetable broth. Increase heat to bring the pot to a gentle boil, then reduce to a simmer. Cook until potatoes are tender and easily pierced with a fork, about 12–15 minutes depending on dice size. Make Milk-Thickener Mix: Whisk together 2 cups milk and 2 tablespoons all-purpose flour in a separate bowl until smooth. This prevents lumps and creates a silky liaison that will thicken the soup gradually when added. Add Milk Mix and Broccoli: Reduce heat to low and stir the milk-flour mixture into the simmering pot. Add the finely diced broccoli and simmer gently for 10–15 minutes until broccoli is tender and flavors marry. Avoid a hard boil after adding milk to prevent curdling. Finish with Cheese and Seasoning: Remove pot from direct heat and stir in the freshly grated sharp cheddar until fully melted and smooth. Return to very low heat if needed to melt completely; the soup will continue to thicken as it cools. Taste and add salt as needed before serving. User provided content image 1

You Must Know

  • Vegetable piece size matters: small, uniform dice ensures even cooking—aim for 1/4 to 1/2 inch for potatoes and carrots.
  • Freshly grate the cheddar for the best melt and gloss; pre-shredded cheese contains anti-caking agents that can make the soup grainy.
  • The potatoes contribute natural thickening; simmering longer will give a thicker body as the starches break down.
  • This stores well: refrigerate in an airtight container for up to 4 days or freeze for up to 3 months; thaw slowly in the fridge before reheating gently.

What I love most is how this bowl bridges comfort and nutrition—the vegetables remain the stars while the cheesy, velvety broth invites spoonful after spoonful. It's the kind of pot that becomes associated with slow evenings, family chatter, and cozy blankets.

Storage Tips

Cool the soup to near room temperature within two hours of cooking, then transfer to airtight containers. In the refrigerator it will keep for up to 4 days; for longer storage portion into freezer-safe containers and freeze for up to 3 months. When reheating from refrigerated or thawed, warm gently over low heat, stirring frequently to reincorporate any separated dairy. If the soup becomes too thick after refrigeration, stir in a splash of milk or broth while reheating to reach desired consistency. Glass containers with tight lids are ideal for reheating in the microwave or on the stove.

Ingredient Substitutions

If you need dairy-free options, swap butter for olive oil, use a plant-based milk (unsweetened oat or soy), and choose a vegan cheddar alternative that melts well. For a gluten-free finish, replace the flour liaison with a cornstarch slurry—mix 1 tablespoon cornstarch with 2 tablespoons cold water and stir in near the end of cooking; allow a few minutes to thicken. Sweet potatoes can replace russets for a sweeter profile, though the texture and thickening behavior will differ. Low-sodium broth gives you better control over the final salt level.

User provided content image 2

Serving Suggestions

Serve steaming bowls with a sprinkle of extra freshly grated cheddar and a crack of black pepper. Crusty bread, buttered toast, or a warm baguette for dipping are classic companions. For a heartier meal, top with toasted croutons, chopped ham, or a scoop of cooked quinoa. Garnish ideas include chopped chives, a drizzle of olive oil, or a few florets of lightly steamed broccoli for color. Pair the bowl with a simple green salad and pickled vegetables for contrast.

Cultural Background

While not tied to a single traditional dish, this style of vegetable-forward, cheesy soup reflects American comfort cooking that blends simple produce with dairy to create creamy, satisfying bowls. The technique of using starchy potatoes to naturally thicken a broth has roots in home-cooking across many cultures—turning humble ingredients into a silky, nourishing meal. Broccoli-cheddar combinations became popular in cafeteria and diner cooking in the mid-20th century and have since evolved into homemade variations like this one.

Seasonal Adaptations

In winter, swap broccoli for roasted winter greens or add a pinch of smoked paprika for warmth. Spring versions benefit from fresh peas and baby spinach stirred in at the end; reduce the potato slightly and add more spring vegetables. For autumn, introduce roasted butternut squash in place of some potatoes for a sweeter, richer profile. Adjust the cheddar to a milder or sharper variety to match seasonal menus and guests’ preferences.

Meal Prep Tips

Make a double batch and freeze individual portions for easy lunches or weeknight dinners. Cool and portion into 2-cup containers for single servings. Label with date and reheat gently from thawed or frozen—if frozen, thaw overnight in the refrigerator before reheating. This soup also works well as a base: halve a portion and add cooked grains or shredded chicken at mealtime for variety. Store garnishes separately to keep textures fresh when serving later.

Whether you’re ladling it into bowls for family weeknight dinner or offering it in a thermos for a cozy lunch, this creamy vegetable soup is a reliably comforting choice. I hope it becomes one of your pantry-pleasing staples and brings warm moments to your table.

Pro Tips

  • Dice vegetables uniformly (1/4–1/2 inch) so they cook evenly and finish at the same time.

  • Freshly grate sharp cheddar for a smooth melt; pre-shredded cheese can make the soup grainy.

  • Avoid boiling after adding milk to prevent curdling—simmer gently at low heat.

  • If soup thickens too much after chilling, thin with a splash of milk or broth while reheating.

This nourishing creamy vegetable soup (broccoli, potato & carrot) recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Vegetariansoupvegetarianfamily-friendlywinter comfortAmerican cuisinecreamy soup
No ratings yet

Creamy Vegetable Soup (Broccoli, Potato & Carrot)

This Creamy Vegetable Soup (Broccoli, Potato & Carrot) recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 6 steaks
Creamy Vegetable Soup (Broccoli, Potato & Carrot)
Prep:15 minutes
Cook:35 minutes
Rest Time:10 mins
Total:50 minutes

Instructions

1

Prepare Ingredients

Peel and dice potatoes and carrots into 1/4–1/2 inch pieces. Dice the onion and mince garlic. Chop broccoli into small florets so they cook in 10–15 minutes.

2

Sweat Aromatics

In a Dutch oven over medium-low heat, melt butter and add onion and garlic. Cook 7–10 minutes until onion is translucent but not browned.

3

Add Carrots

Stir in diced carrots and cook about 5 minutes to soften slightly and jump-start their cooking.

4

Simmer Potatoes

Add diced potatoes and pour in 32 fl oz vegetable broth. Bring to a gentle boil, then simmer until potatoes are fork-tender, about 12–15 minutes.

5

Add Milk-Flour Mix and Broccoli

Whisk milk and flour until smooth, then stir into the pot over low heat. Add broccoli and simmer 10–15 minutes until tender. Avoid high boil after adding milk.

6

Finish with Cheese and Season

Remove from heat and stir in freshly grated cheddar until melted and smooth. Taste and add salt as needed. The soup will thicken as it cools.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 365kcal | Carbohydrates: 34g | Protein:
15g | Fat: 20g | Saturated Fat: 6g |
Polyunsaturated Fat: 4g | Monounsaturated Fat:
8g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@yummique on social media!

Creamy Vegetable Soup (Broccoli, Potato & Carrot)

Categories:

Creamy Vegetable Soup (Broccoli, Potato & Carrot)

Did You Make This?

Leave a comment & rating below or tag @yummique on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Amira!

Chef and recipe creator specializing in delicious Vegetarian cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.